Apolipoprotein E3, Recombinant, Human (Apo E3)
Catalog No : USB-A2299-76G1
367.83€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Apolipoprotein E3, Recombinant, Human (Apo E3) | ||
|---|---|---|---|
| Catalog No | USB-A2299-76G1 | ||
| Supplier’s Catalog No | A2299-76G1 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 34 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ≥90% (SDS-PAGE and HPLC). Endotoxin: ≤0.1ng/ug | ||
| Form | Supplied as a a lyophilized powder from 20mM sodium phosphate. Reconstitute in 5mM sodium phosphate, pH 7.8, 0.5mMDTT to a concentration of 0.1-1mg/ml. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Description | ApoE belongs to a group of proteins that bind reversibly with lipoprotein and play an important role in lipid metabolism. In addition to facilitating solublization of lipids, these proteins help to maintain the structural integrity of lipoproteins, serve as ligands for lipoprotein receptors, and regulate the activity of enzymes involved in lipid metabolism. Significant quantities of ApoE are produced in liver and brain and to some extent in almost every organ. ApoE is an important constituent of all plasma lipoproteins. It's interaction with specific ApoE receptor enables uptake of chylomicron remnants by liver cells, which is an essential step during normal lipid metabolism. It also binds with the LDL receptor (apo B/E). Defects in ApoE are a cause of hyperlipoproteinemia type III. ApoE exists in three major isoforms; E2, E3, and E4, which differ from one another by a single amino-acid substitution. E3 is the most common isoform and is present in 40-90% of the population. Recombinant human ApoE3 is a 34.0kD protein containing 299 amino acid residues. AA Sequence: HMKVEQVVETEPEPELRQQAEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELTALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGVSAIRERLGPLVEQGRVRAATVGSVAGKPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with 5mM sodium phosphate, pH 7.8, 0.5mM DTT. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved