β-Endorphin, Rat, Control Peptide
Catalog No : USB-E2300-03A
564.38€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | β-Endorphin, Rat, Control Peptide | ||
|---|---|---|---|
| Catalog No | USB-E2300-03A | ||
| Supplier’s Catalog No | E2300-03A | ||
| Supplier | US Biologicals | ||
| Source antigen | Rat synthetic peptide | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | 95+% HPLC, Mass Spec | ||
| Form | Supplied as a white to off-white lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | 95+% HPLC, Mass Spec | ||
| Description | Control Peptide for E2300-03 Sequence (linear): YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Stable for 12 months at -20°C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved