β-Endorphin, Rat, Control Peptide

Catalog No : USB-E2300-03A
564.38€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name β-Endorphin, Rat, Control Peptide
Catalog No USB-E2300-03A
Supplier’s Catalog No E2300-03A
Supplier US Biologicals
Source antigen Rat synthetic peptide
Reactivity
Cross reactivity
Applications
Molecular weight
Storage -20°C
Other names
Grade Purified
Purity 95+% HPLC, Mass Spec
Form Supplied as a white to off-white lyophilized powder.
Reactivity life 12 months
Note For reserch purpose only
Purity 95+% HPLC, Mass Spec
Description Control Peptide for E2300-03 Sequence (linear): YGGFMTSKSQTPLVTLFKNAIIKNAYKKGE Storage and Stability: Lyophilized powder may be stored at 4°C for short-term only. Stable for 12 months at -20°C. Reconstitute to nominal volume (see reconstitution instructions for peptides) and store at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.