Brain Natriuretic Peptide, Recombinant, Human (BNP)
Catalog No : USB-B2702-30
377.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Brain Natriuretic Peptide, Recombinant, Human (BNP) | ||
|---|---|---|---|
| Catalog No | USB-B2702-30 | ||
| Supplier’s Catalog No | B2702-30 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥ 95% by RP-HPLC, FPLC, or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified. Endotoxin: ≤0.1ng/ug (IEU/ug) | ||
| Form | Supplied as a lyophilized powder in PBS. Reconstitute with sterile, dH2O, 0.1% HSA or BSA to a concentration of ≥0.1mg/ml. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥ 95% by RP-HPLC, FPLC, or reducing/non-reducing SDS-PAGE Silver Stain. Chromatographically purified. Endotoxin: ≤0.1ng/ug (IEU/ug) | ||
| Description | Brain Natriuretic Protein is a protein secreted by the brain and the heart atria, stored mainly in cardiac ventricular myocardium. It can cause Natriuresis; Diuresis; Vasodilation; and inhibits secretion of Renin and Aldosterone. It improves heart function. BNP contains 32 Amino acids. Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute to nominal volume by adding sterile, dH2O, 0.1% HSA or BSA. Aliquot and store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved