Osteoprotegerin/Fc Chimera, Recombinant, Human (OPG-Fc)
Catalog No : USB-360925
477.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Osteoprotegerin/Fc Chimera, Recombinant, Human (OPG-Fc) | ||
|---|---|---|---|
| Catalog No | USB-360925 | ||
| Supplier’s Catalog No | 360925 | ||
| Supplier | US Biologicals | ||
| Source antigen | Pichia Pastoris | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 46.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE, HPLC) | ||
| Form | Supplied as a lyophilized powder in PBS, pH 7.4. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE, HPLC) | ||
| Description | Source: Recombinant protein corresponding to 412aa residues, including 180 residues from mature OPG (aa22-201) and 232 residues from the Fc protein of human IgG1 from human Osteoprotegerin/Fc Chimera expressed in Pichia Pastoris. Molecular Weight: ~46.5kD (412aa) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Biological Activity: Fully biologically active when compared to the standard. Determined by its ability to neutralize the stimulation of U937 cells treated with 10ng/ml of soluble RANKL. Endotoxin: <1EU/mg (LAL) AA Sequence: ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGN SESTQKCGIDVTL Fc232: EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved