TIMP-1, Recombinant, Human (Tissue inhibitor of metalloproteinases, Fibroblast collagenase inhibitor, Erythroid-potentiating activity)
Catalog No : USB-143523
354.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | TIMP-1, Recombinant, Human (Tissue inhibitor of metalloproteinases, Fibroblast collagenase inhibitor, Erythroid-potentiating activity) | ||
|---|---|---|---|
| Catalog No | USB-143523 | ||
| Supplier’s Catalog No | 143523 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥95% by SDS-PAGE gel and HPLC analyses. | ||
| Form | Supplied as a lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥95% by SDS-PAGE gel and HPLC analyses. | ||
| Description | TIMP1 is an extracellular inhibitor of MMPs (see above) including MMP1, 2, 3, 7, 8, 9, 10, 11, 12, 13, and 16. It belongs to the I35 (TIMP) family of irreversible protease inhibitors that function as key modulators of extracellular matrix degradation during tissue development and remodeling.TIMP1 can also act through an MMP-independent mechanism to promote erythropoiesis by stimulating proliferation and differentiation of erythroid progenitors. Recombinant human TIMP-1 is a 20.6kD protein containing 184 amino acid residues. Biological Activity: TIMP1 activity was measured by its ability to inhibit human MMP-1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP-1 concentration of approximately 0.5ug/ml, when using an MMP-1 concentration of 1.6ug/ml. AA Sequence: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | ||
Product Details
© 2020 Imugex All Rights Reserved