APOC2, Recombinant, Human, aa23-101, His-SUMO-Tag (Apolipoprotein C-II)

Catalog No : USB-372298
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name APOC2, Recombinant, Human, aa23-101, His-SUMO-Tag (Apolipoprotein C-II)
Catalog No USB-372298
Supplier’s Catalog No 372298
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 24.9
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase. In normolipidic individuals, it is mainly distributed in the HDL, whereas in hypertriglyceridic individuals, predominantly found in the VLDL and LDL. Source: Recombinant protein corresponding to aa23-101 from human APOC2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD AA Sequence: TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.