Apoc3, Recombinant, Mouse, aa21-99, His-SUMO-Tag (Apolipoprotein C-III)

Catalog No : USB-370525
527.60€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Apoc3, Recombinant, Mouse, aa21-99, His-SUMO-Tag (Apolipoprotein C-III)
Catalog No USB-370525
Supplier’s Catalog No 370525
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 24.8
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors. Source: Recombinant protein corresponding to aa21-99 from mouse Apoc3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.8kD AA Sequence: EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.