LDLR, Recombinant, Human (FH, FHC, LDLR, LDLCQ2, Low Density Lipoprotein Receptor) (Biotin)
Catalog No : USB-172338
726.46€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | LDLR, Recombinant, Human (FH, FHC, LDLR, LDLCQ2, Low Density Lipoprotein Receptor) (Biotin) | ||
|---|---|---|---|
| Catalog No | USB-172338 | ||
| Supplier’s Catalog No | 172338 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 87.7 | ||
| Storage | -80°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥ 80% | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol. Labeled with Biotin. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥ 80% | ||
| Description | The low density lipoprotein receptor (LDLR) gene family consists of cell surface proteins involved in receptor-mediated endocytosis of specific ligands. Low density lipoprotein (LDL) is normally bound at the cell membrane and taken into the cell ending up in lysosomes where the protein is degraded and the cholesterol is made available for repression of microsomal enzyme 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, the rate-limiting step in cholesterol synthesis. At the same time, a reciprocal stimulation of cholesterol ester synthesis takes place. Mutations in this gene cause the autosomal dominant disorder, familial hypercholesterolemia. In case of HIV-1 infection, it functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells. PCSK9 binds to the epidermal growth factor-like repeat A (EGF-A) domain of LDLR, inducing LDLR degradation. Product Description: Human low density lipoprotein receptor (LDLR), also known as FH, FHC, and LDLCQ2, GenBank Accession No. NM_000527, a.a.22-788(end), with C-terminal Flag and Avi tags, MW=87.7kD*, expressed in a HEK293 cell expression system and enzymatically biotinylated. *Note: LDLR is heavily glycosylated, resulting in higher molecular weight. The two bands shown correspond to differing states of glycosylation. AA Sequence: AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTL DRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVRDYKDDDDKGGGLNDIFEAQKIEWHE Applications: Suitable for use in the study of protein binding and screening small molecules for drug discovery. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Stable for 6 months when stored at -80°C. Avoid freeze-thaw cycles. Storing diluted protein is not recommended; if necessary, include carrier protein (e.g., 0.1-0.5% BSA). For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved