ApoE3, Recombinant, Human (Apoprotein E3)
Catalog No : USB-143280
354.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | ApoE3, Recombinant, Human (Apoprotein E3) | ||
|---|---|---|---|
| Catalog No | USB-143280 | ||
| Supplier’s Catalog No | 143280 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥90% by SDS-PAGE gel and HPLC analyses. | ||
| Form | Supplied as a lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥90% by SDS-PAGE gel and HPLC analyses. | ||
| Description | ApoE3 belongs to a group of proteins that bind reversibly with lipoprotein and play an important role in lipid metabolism.In addition to facilitating solublization of lipids, these proteins help to maintain the structural integrity of lipoproteins, serve as ligands for lipoprotein receptors, and regulate the activity of enzymes involved in lipid metabolism.Significant quantities of ApoE are produced in liver and brain and to some extent in almost every organ.ApoE exists in three major isoforms E2, E3, and E4, which differ from one another by a single amino-acid substitution.E3 is the most common isoform and is present in 40-90% of the population. Recombinant human ApoE3 is a 34.0kD protein containing 299 amino acid residues. AA Sequence: MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | ||
Product Details
© 2020 Imugex All Rights Reserved