ApoE2, Recombinant, Human (Apolipoprotein E2)
Catalog No : USB-143279
354.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | ApoE2, Recombinant, Human (Apolipoprotein E2) | ||
|---|---|---|---|
| Catalog No | USB-143279 | ||
| Supplier’s Catalog No | 143279 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥90% by SDS-PAGE gel and HPLC analyses. | ||
| Form | Supplied as a lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥90% by SDS-PAGE gel and HPLC analyses. | ||
| Description | ApoE belongs to a group of proteins that bind reversibly with lipoprotein and play an important role in lipid metabolism.In addition to facilitating solublization of lipids, these proteins help to maintain the structural integrity of lipoproteins, serve as ligands for lipoprotein receptors, and regulate the activity of enzymes involved in lipid metabolism.Significant quantities of ApoE are produced in liver and brain and to some extent in almost every organ.ApoE is an important constituent of all plasma lipoproteins.Itrsquos interaction with specific ApoE receptor enables uptake of chylomicron remnants by liver cells, which is an essential step during normal lipid metabolism.It also binds with the LDL receptor (apo B/E).Defects in ApoE are a cause of hyperlipoproteinemia type III.ApoE exists in three major isoforms E2, E3, and E4, which differ from one another by a single amino-acid substitution.Compared with E3 and E4, E2 exhibits the lowest receptor binding affinity.E2 allele carriers had significantly lower levels of total cholesterol, low-density lipoprotein cholesterol, and non-high-density lipoprotein cholesterol, as well as increased ApoE levels.Recombinant human ApoE2 is a 34.3kD protein containing 300 amino acid residues. AA Sequence: MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | ||
© 2020 Imugex All Rights Reserved