ApoA-I, Recombinant, Human (Apolipoprotein A-I)
Catalog No : USB-143278
354.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | ApoA-I, Recombinant, Human (Apolipoprotein A-I) | ||
|---|---|---|---|
| Catalog No | USB-143278 | ||
| Supplier’s Catalog No | 143278 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥97% by SDS-PAGE gel and HPLC analyses. | ||
| Form | Supplied as a lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥97% by SDS-PAGE gel and HPLC analyses. | ||
| Description | ApoA-I is a 29.0kD protein produced in the liver and intestine, and secreted as the predominant constituent of nascent high-density lipoprotein (HDL) particle.ApoA-I, which is found exclusively in HDL, has a unique ability to capture and solubilize free cholesterol.This apoA-I ability enables HDL to remove excess peripheral cholesterol and return it to the liver for recycling and excretion.This process, called reverse cholesterol transport, is though to inhibit atherogenesis.For this reason HDL is also known as the good cholesterol. The therapeutic potential of apoA-I has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-I (called apoA-I Milano).The availability of recombinant normal apoA-I should facilitate further investigation into the potential usefulness of apoA-I in preventing atherosclerotic vascular diseases.Recombinant human ApoA-I is a 28.2kD protein of 244 amino acid residues. AA Sequence: MDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ Crossreactivity: Hamster Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | ||
Product Details
© 2020 Imugex All Rights Reserved