Allergen Bla g 4, Recombinant, Blattella Germanica, aa13-182, His-Tag
Catalog No : USB-370510
578.18€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Allergen Bla g 4, Recombinant, Blattella Germanica, aa13-182, His-Tag | ||
|---|---|---|---|
| Catalog No | USB-370510 | ||
| Supplier’s Catalog No | 370510 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 35.77 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Probable ligand-binding protein. Source: Recombinant protein corresponding to aa13-182 from blattella germanica Allergen Bla g 4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.77kD AA Sequence: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved