Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495)
Catalog No : USB-517855
471.28€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Cyanovirin-N Homolog, Recombinant, Neurospora Crassa, aa1-111, His-Tag (NCU05495) | ||
|---|---|---|---|
| Catalog No | USB-517855 | ||
| Supplier’s Catalog No | 517855 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE.) | ||
| Form | Supplied as a liquid in Tris-based buffer, 50% glycerol | ||
| Reactivity life | |||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE.) | ||
| Description | Mannose-binding lectin. Source: Recombinant full length protein corresponding to aa1-111 of Neurospora Crassa Cyanovirin-N Homolog, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.9kD AA Sequence: MSFHVTAEDARIEVRDNRTILFARLRREDGEWNDASYELDQIIGNNDGHFQWGGQNFTETAEDIRFHPKEGAAEQPILRARLRDCNGEFHDRDVNLTEIVENVNGEFQAKF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved