Sialic Acid-binding Lectin, Recombinant, Rana Japonica, aa1-111, His-Tag

Catalog No : USB-375295
506.91€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Sialic Acid-binding Lectin, Recombinant, Rana Japonica, aa1-111, His-Tag
Catalog No USB-375295
Supplier’s Catalog No 375295
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 16.3
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description The S-lectins in frog eggs may be involved in the fertilization and development of the frog embryo. This lectin preferentially agglutinate a large variety of tumor cells, but it does not agglutinate non-transformed cells and erythrocytes. Source: Recombinant protein corresponding to aa1-111 from rana japonica Sialic acid-binding lectin, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.3kD AA Sequence: QNWAKFQEKHIPNTSNINCNTIMDKSIYIVGGQCKERNTFIISSATTVKAICSGASTNRNVLSTTRFQLNTCIRSATAPRPCPYNSRTETNVICVKCENRLPVHFAGIGRC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.