MBL2, Recombinant, Human, aa21-248, His-Tag (Mannose-binding Protein C)
Catalog No : USB-374160
445.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | MBL2, Recombinant, Human, aa21-248, His-Tag (Mannose-binding Protein C) | ||
|---|---|---|---|
| Catalog No | USB-374160 | ||
| Supplier’s Catalog No | 374160 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 25.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complent pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA. Source: Recombinant protein corresponding to aa21-248 from human MBL2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.5kD AA Sequence: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved