Sialic Acid Binding Ig Like Lectin 12 (Siglec 12) Recombinant, Mouse
Catalog No : USB-156792
401.16€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Sialic Acid Binding Ig Like Lectin 12 (Siglec 12) Recombinant, Mouse | ||
|---|---|---|---|
| Catalog No | USB-156792 | ||
| Supplier’s Catalog No | 156792 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant Mouse from E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 19.5 | ||
| Storage | 4°C/-70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥95% | ||
| Form | Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥95% | ||
| Description | Source: Recombinant Mouse from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: Q91Y57 Fragment: Leu27~Met141 (Accession No: Q91Y57) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-LNVE RKVVVQEGLC VLVPCNFSYL KKRLTDWTDS DPVHGFWYRE GTDRRKDSIV ATNNPIRKAV KETRNRFFLL GDPWRNDCSL NIREIRKKDA GLYFFRLERG KTKYNYMWDK M Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 19.5kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions. | ||
© 2020 Imugex All Rights Reserved