Keratin 6A (KRT6A) Recombinant, Human
Catalog No : USB-155531
405.76€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Keratin 6A (KRT6A) Recombinant, Human | ||
|---|---|---|---|
| Catalog No | USB-155531 | ||
| Supplier’s Catalog No | 155531 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant Human from E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 41.3 | ||
| Storage | 4°C/-70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥95% | ||
| Form | Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥95% | ||
| Description | Source: Recombinant Human from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: P02538 Fragment: Glu163~Leu468 (Accession No: P02538) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-EREQIKTL NNKFASFIDK VRFLEQQNKV LETKWTLLQE QGTKTVRQNL EPLFEQYINN LRRQLDSIVG ERGRLDSELR GMQDLVEDFK NKYEDEINKR TAAENEFVTL KKDVDAAYMN KVELQAKADT LTDEINFLRA LYDAELSQMQ THISDTSVVL SMDNNRNLDL DSIIAEVKAQ YEEIAQRSRA EAESWYQTKY EELQVTAGRH GDDLRNTKQE IAEINRMIQR LRSEIDHVKK QCANLQAAIA DAEQRGEMAL KDAKNKLEGL EDALQKAKQD LARLLKEYQE LMNVKLALDV EIATYRKL Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 41.3kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions. | ||
© 2020 Imugex All Rights Reserved