SLC34A2, Recombinant, Human, aa574-689, His-Tag (Sodium-dependent Phosphate Transport Protein 2B)
Catalog No : USB-375321
445.99€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SLC34A2, Recombinant, Human, aa574-689, His-Tag (Sodium-dependent Phosphate Transport Protein 2B) | ||
|---|---|---|---|
| Catalog No | USB-375321 | ||
| Supplier’s Catalog No | 375321 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 15.1 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli. Source: Recombinant protein corresponding to aa574-689 from human SLC34A2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.1kD AA Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved