Small Delta Antigen, Recombinant, Hepatitis Delta Virus Genotype I, aa1-195, His-tag, Myc-tag
Catalog No : USB-405940
497.72€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Small Delta Antigen, Recombinant, Hepatitis Delta Virus Genotype I, aa1-195, His-tag, Myc-tag | ||
|---|---|---|---|
| Catalog No | USB-405940 | ||
| Supplier’s Catalog No | 405940 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 25.4 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Source: Recombinant full length protein corresponding to aa1-195 from Hepatitis Delta Virus Genotype I Small Delta Antigen, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in Yeast. Molecular Weight: ~25.4kD AA Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved