VCATH, Recombinant, Autographa Californica Nuclear Polyhedrosis Virus, aa113-323, His-SUMO-Tag (Viral Cathepsin)
Catalog No : USB-375810
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | VCATH, Recombinant, Autographa Californica Nuclear Polyhedrosis Virus, aa113-323, His-SUMO-Tag (Viral Cathepsin) | ||
|---|---|---|---|
| Catalog No | USB-375810 | ||
| Supplier’s Catalog No | 375810 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 39.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system. Source: Recombinant protein corresponding to aa113-323 from autographa californica nuclear polyhedrosis virus VCATH, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.9kD AA Sequence: PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved