Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor)
Catalog No : USB-375222
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Scn, Recombinant, Staphylococcus Aureus, aa32-116, His-SUMO-Tag (Staphylococcal Complement Inhibitor) | ||
|---|---|---|---|
| Catalog No | USB-375222 | ||
| Supplier’s Catalog No | 375222 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 25.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycero | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses (By similarity). Source: Recombinant protein corresponding to aa32-116 from staphylococcus aureus Scn, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.8kD AA Sequence: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved