lecA, Recombinant, Pseudomonas Aeruginosa, aa2-122, His-Tag (PA-I Galactophilic Lectin)
Catalog No : USB-374005
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | lecA, Recombinant, Pseudomonas Aeruginosa, aa2-122, His-Tag (PA-I Galactophilic Lectin) | ||
|---|---|---|---|
| Catalog No | USB-374005 | ||
| Supplier’s Catalog No | 374005 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 16.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant n its selective (carbohydrate-specific) hagglutinating activity. Source: Recombinant protein corresponding to aa2-122 from pseudomonas aeruginosa lecA, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.8kD AA Sequence: AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved