Envelope Glycoprotein L, Recombinant, Epstein-Barr Virus, aa23-137, His-SUMO-Tag (gL)
Catalog No : USB-373199
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Envelope Glycoprotein L, Recombinant, Epstein-Barr Virus, aa23-137, His-SUMO-Tag (gL) | ||
|---|---|---|---|
| Catalog No | USB-373199 | ||
| Supplier’s Catalog No | 373199 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 28.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. Fusion of EBV with B-lymphocytes requires the additional receptor-binding protein gp42, which forms a complex with gH/gL. May also be required for virus attachment to epithelial cells. Source: Recombinant protein corresponding to aa23-137 from epstein-barr virus gL, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~28.7kD AA Sequence: NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved