Heat-labile Enterotoxin B Chain, Recombinant, E. coli, aa22-124, His-Tag (eltB)
Catalog No : USB-373174
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Heat-labile Enterotoxin B Chain, Recombinant, E. coli, aa22-124, His-Tag (eltB) | ||
|---|---|---|---|
| Catalog No | USB-373174 | ||
| Supplier’s Catalog No | 373174 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 15.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase. Source: Recombinant protein corresponding to aa22-124 from E. coli Heat-labile Enterotoxin B Chain, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.7kD AA Sequence: APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved