BALF5, Recombinant, Epstein-Barr virus, aa1-210, His-SUMO-Tag (DNA Polymerase Catalytic Subunit)
Catalog No : USB-372405
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | BALF5, Recombinant, Epstein-Barr virus, aa1-210, His-SUMO-Tag (DNA Polymerase Catalytic Subunit) | ||
|---|---|---|---|
| Catalog No | USB-372405 | ||
| Supplier’s Catalog No | 372405 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 39.2 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Replicates viral genomic DNA in the late phase of lytic infection, producing long concateric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein. Source: Recombinant protein corresponding to aa1-210 from epstein-barr virus DNA Polymerase Catalytic Subunit, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.2kD AA Sequence: MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved