Invasin, Recombinant, Yersinia Enterocolitica, aa1-835, His-Tag
Catalog No : USB-370670
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Invasin, Recombinant, Yersinia Enterocolitica, aa1-835, His-Tag | ||
|---|---|---|---|
| Catalog No | USB-370670 | ||
| Supplier’s Catalog No | 370670 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH 8.0, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins. Source: Recombinant protein corresponding to aa1-835 from Yersinia enterocolitica Invasin, fused to His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P19196 AA Sequence: VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved