TIM-3, Recombinant, Human, aa22-200, FLAG-tag (T-Cell Immunoglobulin Mucin Receptor 3, T-Cell Membrane Protein 3, TIMD-3, Hepatitis A Virus Cellular Receptor 2, HAVCR-2, KIM-3)
Catalog No : USB-298482
598.87€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | TIM-3, Recombinant, Human, aa22-200, FLAG-tag (T-Cell Immunoglobulin Mucin Receptor 3, T-Cell Membrane Protein 3, TIMD-3, Hepatitis A Virus Cellular Receptor 2, HAVCR-2, KIM-3) | ||
|---|---|---|---|
| Catalog No | USB-298482 | ||
| Supplier’s Catalog No | 298482 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, HEK293 cells | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 20.8 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | Highly Purified (~90%) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Highly Purified (~90%) | ||
| Description | The protein encoded by this gene belongs to the immunoglobulin superfamily, and TIM family of proteins. CD4-positive T helper lymphocytes can be divided into types 1 (Th1) and 2 (Th2) on the basis of their cytokine secretion patterns. Th1 cells are involved in cell-mediated immunity to intracellular pathogens and delayed-type hypersensitivity reactions, whereas, Th2 cells are involved in the control of extracellular helminthic infections and the promotion of atopic and allergic diseases. This protein is a Th1-specific cell surface protein that regulates macrophage activation, and inhibits Th1-mediated auto- and alloimmune responses, and promotes immunological tolerance. [provided by RefSeq, Sep 2011]. Source: Recombinant protein corresponding to aa22-200 from human TIM-3, fused to FLAG-tag at C-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~20.8kD, protein runs at a higher MW by SDS-PAGE due to glycosylation Endotoxin: <1EU/ug AA Sequence: SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNY WTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTP APTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRD SGATIRDYKDDDDK Applications: Suitable for use in studying protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved