HCV1a (D168V), Recombinant (Hepatitis C virus genotype 1a)
Catalog No : USB-171869
677.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | HCV1a (D168V), Recombinant (Hepatitis C virus genotype 1a) | ||
|---|---|---|---|
| Catalog No | USB-171869 | ||
| Supplier’s Catalog No | 171869 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E.coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 22.4 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~53% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 0.04% Tween 20, 250mM imidazole, 20% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~53% (SDS-PAGE) | ||
| Description | Fusion protein corresponding to the serine protease NS3 (a.a.3-181) and cofactor NS4A (a.a.21-32) from Hepatitis C virus genotype 1a (GenBank Accession No. NC_004102) with Asp-to-Val mutation on a.a.168, and N-terminal FLAG-His tag, MW=22.4kD, expressed in an E. coli expression system. Source: Recombinant protein corresponding to aa3-181 from HCV1a at the N-terminus, with Asp-to-Val mutation on aa 168, an N-terminal FLAG-His-Tag, and a 4aa linker, expressed in E.coli. Molecular Weight: ~22.4kD Application: Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. AA Sequence: MDYKDDDDKHHHHHHGCVVIVGRIVLSGSGSITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVVFIPVENLETTMRS Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap | ||
Product Details
© 2020 Imugex All Rights Reserved