Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Biochemicals / Biochemicals

Product name			Pre-Glycoprotein Polyprotein GP Complex, Recombinant, Lymphocytic Choriomeningitis Virus, aa266-498, His-Sumo-Tag (GPC)
Catalog No			USB-518060
Supplier’s Catalog No			518060
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			42.4

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris-based buffer, 50% glycerol.
Reactivity life
Note			For reserch purpose only
Description			Stable signal peptide (SSP) is cleaved but is apparently retained as the third component of the GP complex. The SSP is required for efficient glycoprotein expression, post-translational cleavage of GP1 and GP2, glycoprotein transport to the cell plasma membrane, formation of infectious virus particles, and acid pH-dependent glycoprotein-mediated cell fusion. Source: Recombinant protein corresponding to aa266-498 of Lymphocytic choriomeningitis virus (strain Armstrong) (LCMV) Pre-Glycoprotein Polyprotein GP Complex, fused to 6xHis-Sumo-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.4kD AA Sequence: GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.