Recombinant Human Fibroblast growth factor 7 (FGF7) Active
Catalog No : IGX-RP2434-10UG
216.38€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Fibroblast growth factor 7 (FGF7) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2434-10UG | ||
| Supplier’s Catalog No | IGX-RP2434-10UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in Mammalian cell | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 10.1 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Fibroblast growth factor 7;FGF-7;Heparin-binding growth factor 7;HBGF-7;Keratinocyte growth factor;FGF7;KGF | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT | ||
© 2020 Imugex All Rights Reserved