Recombinant Human Platelet-derived growth factor subunit B (PDGFB) Active
Catalog No : IGX-RP2211-10UG
216.38€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Platelet-derived growth factor subunit B (PDGFB) Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2211-10UG | ||
| Supplier’s Catalog No | IGX-RP2211-10UG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli | ||
| Reactivity | Human | ||
| Cross reactivity | Human | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 39.4 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived Growth Factor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis; Becaplermin; PDGFB; PDGF2; SIS | ||
| Grade | Highly Purified | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >95% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin Sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT | ||
© 2020 Imugex All Rights Reserved