Recombinant Human Fibroblast growth factor 2 (FGF2), partial Active
Catalog No : IGX-RP2036-1MG
683.93€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Recombinant Human Fibroblast growth factor 2 (FGF2), partial Active | ||
|---|---|---|---|
| Catalog No | IGX-RP2036-1MG | ||
| Supplier’s Catalog No | IGX-RP2036-1MG | ||
| Supplier | ImuGeX | ||
| Source antigen | Recombinant, expressed in E.Coli, 132-288 Amino Acids | ||
| Reactivity | Rhesus macaque | ||
| Cross reactivity | Rhesus macaque | ||
| Applications | Functional studies, Bioassays or User optimised | ||
| Molecular weight | 17.3 KDa | ||
| Storage | Store at -20℃/-80℃. | ||
|---|---|---|---|
| Other names | Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB | ||
| Grade | Highly Purified | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Form | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5 | ||
| Reactivity life | 12 months, when stored accoring to instructions. | ||
| Note | For reserch purpose only, not for In Vivo use or as therapeutics. | ||
| Purity | >98% determined by SDS-PAGE and HPLC, Endotoxin Level: <1.0 EU/µg as determined by LAL method. | ||
| Description | Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis Sequence: GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS. Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml. | ||
© 2020 Imugex All Rights Reserved