mCherry Fluorescent Protein, Recombinant
Catalog No : USB-M2690-20
573.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | mCherry Fluorescent Protein, Recombinant | ||
|---|---|---|---|
| Catalog No | USB-M2690-20 | ||
| Supplier’s Catalog No | M2690-20 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 28.8 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥97% (SDS-PAGE and HPLC) Endotoxin: ≤0.1ng/ug | ||
| Form | Supplied as freeze dried powder. Reconstitute with 100ul sterile ddH2O. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Description | mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. The recombinant mCherry is expressed and purified from transformed E. coli using a method that ensures high purity and maximal fluorescence intensity. The protein is a 28.8kD monomer with 256 amino acids, pI: 6.23. Ex.= 587 nm (540-590 nm); Em.= 610 nm (550-650 nm). The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads. Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Applications: Suitable for use as standard/positive control for SDS-PAGE and for Western Blot analysis of mCherry-transfected cells. Suitable for use in labeling proteins or antibodies. Also suitable for use in calibration of fluorometers and flow cytometers, and fluorescence microscope. mCherry protein can be microinjected into cells and tissues and is also ideal for fuison tag applications. Can be used for triple labeling with EGFP, CFP, YFP and other dyes. The 6xHis-Tag on the N-terminal can be used in Western Blot detection with 6xHis-Tag antibodies. The 6xHis-Tag can also be used in removal or purification of the mCherry protein. Other applications not tested. Storage and Stability: Lyophilized powder may be stored at -70°C. Stable for 12 months at -70°C after receipt. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70°C. Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved