ZNF26, Recombinant, Human, aa335-533, His-SUMO-Tag (Zinc Finger Protein 26)

Catalog No : USB-375915
881.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name ZNF26, Recombinant, Human, aa335-533, His-SUMO-Tag (Zinc Finger Protein 26)
Catalog No USB-375915
Supplier’s Catalog No 375915
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 38.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May be involved in transcriptional regulation. Source: Recombinant protein corresponding to aa335-533 from human ZNF26, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD AA Sequence: MHTGEKPYQCSDCGKAFNMKTQLIVHQGVHTGNNPYQCGECGKAFGRKEQLTAHLRAHAGEKPYGCSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFCGKSQLIIHQRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.