VPS13A, Recombinant, Human, aa3037-3140, His-SUMO-Tag (Vacuolar Protein Sorting-associated Protein 13A)
Catalog No : USB-375844
881.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | VPS13A, Recombinant, Human, aa3037-3140, His-SUMO-Tag (Vacuolar Protein Sorting-associated Protein 13A) | ||
|---|---|---|---|
| Catalog No | USB-375844 | ||
| Supplier’s Catalog No | 375844 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 28.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | May play a role in the control of protein cycling through the trans-Golgi network to early and late endosomes, lysosomes and plasma membrane. Source: Recombinant protein corresponding to aa3037-3140 from human VPS13A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.5kD AA Sequence: RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved