Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			TOMM34, Recombinant, Human, aa1-309, GST-Tag (Mitochondrial Import Receptor Subunit TOM34)
Catalog No			USB-375631
Supplier’s Catalog No			375631
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			61.6

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~90% (SDS-PAGE)
Description			Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state. Source: Recombinant protein corresponding to aa1-309 from human TOMM34, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~61.6kD AA Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.