TNFAIP8, Recombinant, Human, aa2-198, GST-Tag (Tumor Necrosis Factor alpha-induced Protein 8)
Catalog No : USB-375620
881.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | TNFAIP8, Recombinant, Human, aa2-198, GST-Tag (Tumor Necrosis Factor alpha-induced Protein 8) | ||
|---|---|---|---|
| Catalog No | USB-375620 | ||
| Supplier’s Catalog No | 375620 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 49.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. Source: Recombinant protein corresponding to aa2-198 from human TNFAIP8, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.9kD AA Sequence: HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved