Thrsp, Recombinant, Mouse, aa1-150, His-SUMO-Tag (Thyroid Hormone-inducible Hepatic Protein)
Catalog No : USB-375563
1048.31€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Thrsp, Recombinant, Mouse, aa1-150, His-SUMO-Tag (Thyroid Hormone-inducible Hepatic Protein) | ||
|---|---|---|---|
| Catalog No | USB-375563 | ||
| Supplier’s Catalog No | 375563 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 33.1 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB. Source: Recombinant protein corresponding to aa1-150 from mouse Thrsp, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.1kD AA Sequence: MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved