THRSP, Recombinant, Human, aa1-146, GST-Tag (Thyroid Hormone-inducible Hepatic Protein)
Catalog No : USB-375562
881.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | THRSP, Recombinant, Human, aa1-146, GST-Tag (Thyroid Hormone-inducible Hepatic Protein) | ||
|---|---|---|---|
| Catalog No | USB-375562 | ||
| Supplier’s Catalog No | 375562 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 43.6 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB. Source: Recombinant protein corresponding to aa1-146 from human THRSP, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~43.6kD AA Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved