STARD7, Recombinant, Human, aa61-307, GST-Tag (StAR-related Lipid Transfer Protein 7, Mitochondrial)

Catalog No : USB-375430
881.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name STARD7, Recombinant, Human, aa61-307, GST-Tag (StAR-related Lipid Transfer Protein 7, Mitochondrial)
Catalog No USB-375430
Supplier’s Catalog No 375430
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 56.5
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May play a protective role in mucosal tissues by preventing exaggerated allergic responses. Source: Recombinant protein corresponding to aa61-307 from human STARD7, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.5kD AA Sequence: LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.