Sso7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-SUMO-Tag (DNA-binding Protein 7d)

Catalog No : USB-375421
1189.69€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Sso7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-SUMO-Tag (DNA-binding Protein 7d)
Catalog No USB-375421
Supplier’s Catalog No 375421
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 23.1
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Source: Recombinant protein corresponding to aa2-64 from sulfolobus solfataricus DNA-binding Protein 7d, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.1kD AA Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.