SsaA1, Recombinant, Staphylococcus Aureus, aa27-255, His-Tag (Staphylococcal Secretory Antigen SsaA1)

Catalog No : USB-375416
1280.50€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SsaA1, Recombinant, Staphylococcus Aureus, aa27-255, His-Tag (Staphylococcal Secretory Antigen SsaA1)
Catalog No USB-375416
Supplier’s Catalog No 375416
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 27
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Not known; immunogenic protein. Source: Recombinant protein corresponding to aa27-255 from staphylococcus aureus ssaA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.0kD AA Sequence: AEQNNNGYNSNDAQSYSYTYTIDAQGNYHYTWTGNWNPSQLTQNNTYYYNNYNTYSYNNASYNNYYNHSYQYNNYTNNSQTATNNYYTGGSGASYSTTSNNVHVTTTAAPSSNGRSISNGYASGSNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAASSGYTVNNTPKVGAIMQTTQGYYGHVAYVEGVNSNGSVRVSEMNYGHGAGVVTSRTISANQAGSYNFIH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.