Sprr2a, Recombinant, Mouse, aa1-83, His-Tag (Small Proline-rich Protein 2A)
Catalog No : USB-375396
1189.69€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Sprr2a, Recombinant, Mouse, aa1-83, His-Tag (Small Proline-rich Protein 2A) | ||
|---|---|---|---|
| Catalog No | USB-375396 | ||
| Supplier’s Catalog No | 375396 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 13.4 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. Source: Recombinant protein corresponding to aa1-83 from mouse Sprr2a, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~13.4kD AA Sequence: MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved