SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17)
Catalog No : USB-375377
767.84€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SPA17, Recombinant, Human, aa1-146, GST-Tag (Sperm Surface Protein Sp17) | ||
|---|---|---|---|
| Catalog No | USB-375377 | ||
| Supplier’s Catalog No | 375377 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 43.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA and 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Sperm surface zona pellucida binding protein. Helps to bind spermatozoa to the zona pellucida with high affinity. Might function in binding zona pellucida and carbohydrates. Recombinant protein corresponding to aa1-146 from human SPA17, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.8kD Amino Acid Sequence: MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
© 2020 Imugex All Rights Reserved