SFTPC, Recombinant, Human, aa24-58, His-Tag (Pulmonary Surfactant-associated Protein C)

Catalog No : USB-375289
947.15€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SFTPC, Recombinant, Human, aa24-58, His-Tag (Pulmonary Surfactant-associated Protein C)
Catalog No USB-375289
Supplier’s Catalog No 375289
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 5.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. Source: Recombinant protein corresponding to aa24-58 from human SFTPC, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~5.7kD AA Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.