SFTPB, Recombinant, Bovine, aa188-266, His-Tag (Pulmonary Surfactant-Associated Protein B)
Catalog No : USB-375286
863.24€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | SFTPB, Recombinant, Bovine, aa188-266, His-Tag (Pulmonary Surfactant-Associated Protein B) | ||
|---|---|---|---|
| Catalog No | USB-375286 | ||
| Supplier’s Catalog No | 375286 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 10.7 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. Source: Recombinant protein corresponding to aa188-266 from bovine SFTPB, fused to His-B2M-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.7kD AA Sequence: FPIPIPYCWLCRTLIKRIQAVIPKGVLAMTVAQVCHVVPLLVGGICQCLVERYSVILLDTLLGRMLPQLVCGLVLRCSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved