PSAP, Recombinant, Guinea pig, aa1-81, HIs-Tag (Saposin-C)
Catalog No : USB-374895
1280.50€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | PSAP, Recombinant, Guinea pig, aa1-81, HIs-Tag (Saposin-C) | ||
|---|---|---|---|
| Catalog No | USB-374895 | ||
| Supplier’s Catalog No | 374895 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 10.85 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate. Source: Recombinant protein corresponding to aa1-81 from guinea pig Saposin-C, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.85kD AA Sequence: ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved