PPDK, Recombinant, Entamoeba Histolytica, aa1-342, His-SUMO-Tag (Pyruvate, Phosphate Dikinase)

Catalog No : USB-374812
1132.22€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name PPDK, Recombinant, Entamoeba Histolytica, aa1-342, His-SUMO-Tag (Pyruvate, Phosphate Dikinase)
Catalog No USB-374812
Supplier’s Catalog No 374812
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 54.4
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis. Source: Recombinant protein corresponding to aa1-342 from entamoeba histolytica PPDK, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.4kD AA Sequence: MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.