Plasmepsin-1, Recombinant, Plasmodium Falciparum, aa125-452, His-SUMO-Tag (PF14_0076)
Catalog No : USB-374732
1189.69€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Plasmepsin-1, Recombinant, Plasmodium Falciparum, aa125-452, His-SUMO-Tag (PF14_0076) | ||
|---|---|---|---|
| Catalog No | USB-374732 | ||
| Supplier’s Catalog No | 374732 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 52.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Participates in the digestion of the host hoglobin. Initial cleavage at the hinge region of hoglobin, than cleaves at other sites, leading to denaturation of the molecule and to further degradation. Source: Recombinant protein corresponding to aa125-452 from plasmodium falciparum PF14_0076, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.9kD AA Sequence: AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved