PIGX, Recombinant, Human, aa42-230, His-SUMO-Tag (Phosphatidylinositol-glycan Biosynthesis Class X Protein)

Catalog No : USB-374709
881.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name PIGX, Recombinant, Human, aa42-230, His-SUMO-Tag (Phosphatidylinositol-glycan Biosynthesis Class X Protein)
Catalog No USB-374709
Supplier’s Catalog No 374709
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 37.8
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM. Source: Recombinant protein corresponding to aa42-230 from human PIGX, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.8kD AA Sequence: MCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.